PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G0589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 195aa    MW: 22360.2 Da    PI: 7.6696
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G0589genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.75.3e-1361119563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  ++ +r+ +NRe+ArrsR RK++ ++ L   v  L++ N +    ++  +++++++++e+
  Gh_D12G0589  61 RKRKRMLSNRESARRSRMRKQKHLDDLMAQVSDLTNHNNQILTSINVTTQLYSNVEAEN 119
                  57899*************************************99999999999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-1056136No hitNo description
SMARTSM003388.4E-1857121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1459122IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-1261112No hitNo description
PfamPF001703.4E-1061116IPR004827Basic-leucine zipper domain
CDDcd147022.04E-1962113No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MSPVLSEILL SGFMINSTLR RRTHLVQSFS VVFLYCGASS GSSTLRSSSS SEDFQPILDE  60
RKRKRMLSNR ESARRSRMRK QKHLDDLMAQ VSDLTNHNNQ ILTSINVTTQ LYSNVEAENL  120
VLRAQMTELS NRLQSLNEII HFINSSNGVL QSDTNFDQPA YCHPYHQLND DSLMNPWNFS  180
TTNQPFMPSA DMMMY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16081RKRKRMLSNRESARRSRMRKQK
27380RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.104640.0boll| leaf| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436848.11e-114PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2TYH21e-141A0A0D2TYH2_G
STRINGPOPTR_0004s16560.15e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.15e-43basic leucine-zipper 44